Recombinant Human ENO1
Cat.No. : | ENO1-28561TH |
Product Overview : | Recombinant full length Human ENO1 expressed in Saccharomyces cerevisiae; 434 amino acids, MWt 47.1 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy. |
Tissue specificity : | The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGAS TGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALV SKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGG SHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKN VIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYIS PDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTAS AGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGL CTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGR NFRNPLAK |
Sequence Similarities : | Belongs to the enolase family. |
Full Length : | Full L. |
Gene Name | ENO1 enolase 1, (alpha) [ Homo sapiens ] |
Official Symbol | ENO1 |
Synonyms | ENO1; enolase 1, (alpha); ENO1L1, MPB1; alpha-enolase; c-myc promoter-binding protein-1; MBP 1; PPH; |
Gene ID | 2023 |
mRNA Refseq | NM_001201483 |
Protein Refseq | NP_001188412 |
MIM | 172430 |
Uniprot ID | P06733 |
Chromosome Location | 1p36.2 |
Pathway | Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; |
Function | DNA binding; lyase activity; magnesium ion binding; phosphopyruvate hydratase activity; protein binding; |
◆ Recombinant Proteins | ||
ENO1-022H | Recombinant Human ENO1 Protein | +Inquiry |
ENO1-3309H | Recombinant Human ENO1 Protein, GST-tagged | +Inquiry |
ENO1-0499H | Recombinant Human ENO1 Protein (M1-K434), His/Strep tagged | +Inquiry |
ENO1-1474R | Recombinant Rhesus monkey ENO1 Protein, His-tagged | +Inquiry |
ENO1-7454H | Recombinant Human ENO1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO1-6599HCL | Recombinant Human ENO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENO1 Products
Required fields are marked with *
My Review for All ENO1 Products
Required fields are marked with *
0
Inquiry Basket