Recombinant Human ENO1

• Cat.No.: ENO1-28561TH
• Product Overview: Recombinant full length Human ENO1 expressed in Saccharomyces cerevisiae; 434 amino acids, MWt 47.1 kDa. Protein is tagged with 26 kDa proprietary tag.

Specification

• Species: Human
• Tag: Non
• Description: This gene encodes alpha-enolase, one of three enolase isoenzymes found in mammals. Each isoenzyme is a homodimer composed of 2 alpha, 2 gamma, or 2 beta subunits, and functions as a glycolytic enzyme. Alpha-enolase in addition, functions as a structural lens protein (tau-crystallin) in the monomeric form. Alternative splicing of this gene results in a shorter isoform that has been shown to bind to the c-myc promoter and function as a tumor suppressor. Several pseudogenes have been identified, including one on the long arm of chromosome 1. Alpha-enolase has also been identified as an autoantigen in Hashimoto encephalopathy.
• Tissue specificity: The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSILKIHAREIFDSRGNPTVEVDLFTSKGLFRAAVPSGAS TGIYEALELRDNDKTRYMGKGVSKAVEHINKTIAPALV SKKLNVTEQEKIDKLMIEMDGTENKSKFGANAILGVSLAVCKAGAVEKGVPLYRHIADLAGNSEVILPVPAFNVINGG SHAGNKLAMQEFMILPVGAANFREAMRIGAEVYHNLKN VIKEKYGKDATNVGDEGGFAPNILENKEGLELLKTAIGKAGYTDKVVIGMDVAASEFFRSGKYDLDFKSPDDPSRYIS PDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTAS AGIQVVGDDLTVTNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIADLVVGL CTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGR NFRNPLAK
• Sequence Similarities: Belongs to the enolase family.
• Full Length: Full L.

Gene Information

• Gene Name: ENO1 enolase 1, (alpha) [ Homo sapiens ]
• Official Symbol: ENO1
• Synonyms: ENO1; enolase 1, (alpha); ENO1L1, MPB1; alpha-enolase; c-myc promoter-binding protein-1; MBP 1; PPH
• Gene ID: 2023
• mRNA Refseq: NM_001201483
• Protein Refseq: NP_001188412
• MIM: 172430
• Uniprot ID: P06733
• Chromosome Location: 1p36.2
• Pathway: Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem
• Function: DNA binding; lyase activity; magnesium ion binding; phosphopyruvate hydratase activity; protein binding