Recombinant Human EMR1 protein, His-tagged

• Cat.No.: EMR1-7854H
• Product Overview: Recombinant Human EMR1 protein(430-510 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 430-510 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: EMR1
• Synonyms: EMR1; egf-like module containing, mucin-like, hormone receptor-like 1; egf like module containing, mucin like, hormone receptor like sequence 1 , TM7LN3; EGF-like module-containing mucin-like hormone receptor-like 1; EMR1 hormone receptor; EGF-like module receptor 1; egf-like module containing, mucin-like, hormone receptor-like sequence 1; TM7LN3
• Gene ID: 2015
• mRNA Refseq: NM_001256252
• Protein Refseq: NP_001243181
• MIM: 600493
• UniProt ID: Q14246