Recombinant Human EMR1 protein, His-tagged

Cat.No. : EMR1-7854H
Product Overview : Recombinant Human EMR1 protein(430-510 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 430-510 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol EMR1
Synonyms EMR1; egf-like module containing, mucin-like, hormone receptor-like 1; egf like module containing, mucin like, hormone receptor like sequence 1 , TM7LN3; EGF-like module-containing mucin-like hormone receptor-like 1; EMR1 hormone receptor; EGF-like module receptor 1; egf-like module containing, mucin-like, hormone receptor-like sequence 1; TM7LN3;
Gene ID 2015
mRNA Refseq NM_001256252
Protein Refseq NP_001243181
MIM 600493
UniProt ID Q14246

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EMR1 Products

Required fields are marked with *

My Review for All EMR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon