Recombinant Human EMP1 Protein, GST-tagged

• Cat.No.: EMP1-3286H
• Product Overview: Human EMP1 full-length ORF ( AAH47300, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EMP1 (Epithelial Membrane Protein 1) is a Protein Coding gene. Diseases associated with EMP1 include Endobronchial Lipoma. An important paralog of this gene is EMP2.
• Molecular Mass: 43.01 kDa
• AA Sequence: MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EMP1 epithelial membrane protein 1 [ Homo sapiens ]
• Official Symbol: EMP1
• Synonyms: epithelial membrane protein 1; 3333; Ensembl:ENSG00000134531; epithelial membrane protein 1;tumor-associated membrane protein; TMP; CL-20; EMP-1
• Gene ID: 2012
• mRNA Refseq: NM_001423
• Protein Refseq: NP_001414
• MIM: 602333
• UniProt ID: P54849