Recombinant Human EML2 Protein (1-418 aa), His-SUMO-tagged
Cat.No. : | EML2-481H |
Product Overview : | Recombinant Human EML2 Protein (1-418 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-418 aa |
Description : | Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ] |
Official Symbol | EML2 |
Synonyms | EML2; ELP70; EMAP 2; EMAP2; EMAP-2; |
Gene ID | 24139 |
mRNA Refseq | NM_001193268 |
Protein Refseq | NP_001180197 |
UniProt ID | O95834 |
◆ Recombinant Proteins | ||
EML2-5180M | Recombinant Mouse EML2 Protein | +Inquiry |
EML2-2093R | Recombinant Rat EML2 Protein | +Inquiry |
EML2-2880H | Recombinant Human EML2 Protein (Gly375-Val649), N-His tagged | +Inquiry |
EML2-4245HF | Recombinant Full Length Human EML2 Protein, GST-tagged | +Inquiry |
EML2-3323Z | Recombinant Zebrafish EML2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EML2-247HCL | Recombinant Human EML2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EML2 Products
Required fields are marked with *
My Review for All EML2 Products
Required fields are marked with *
0
Inquiry Basket