Recombinant Human EMC10 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EMC10-4747H
• Product Overview: C19orf63 MS Standard C13 and N15-labeled recombinant protein (NP_778233) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: EMC10 (ER Membrane Protein Complex Subunit 10) is a Protein Coding gene. Diseases associated with EMC10 include Myocardial Infarction.
• Molecular Mass: 26.6 kDa
• AA Sequence: MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EMC10 ER membrane protein complex subunit 10 [ Homo sapiens (human) ]
• Official Symbol: EMC10
• Synonyms: EMC10; ER membrane protein complex subunit 10; HSM1; HSS1; C19orf63; ER membrane protein complex subunit 10; UPF0510 protein INM02; hematopoietic signal peptide-containing membrane domain-containing 1; hematopoietic signal peptide-containing secreted 1
• Gene ID: 284361
• mRNA Refseq: NM_175063
• Protein Refseq: NP_778233
• MIM: 614545
• UniProt ID: Q5UCC4