Recombinant Human ELMOD2 Protein, GST-tagged

• Cat.No.: ELMOD2-3258H
• Product Overview: Human ELMOD2 full-length ORF ( AAH15168, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes one of six engulfment and motility (ELMO) domain-containing proteins. This gene is thought to play a role in antiviral responses. Mutations in this gene may be involved in the cause of familial idiopathic pulmonary fibrosis. [provided by RefSeq, Sep 2010]
• Molecular Mass: 57.97 kDa
• AA Sequence: MFISLWEFFYGHFFRFWMKWLLRQMTGKCELQRIFDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNINPEKDASFKICMKMCLLQITGYKQLYLDVESVRKRPYDSDNLQHEELLMKLWNLLMPTKKLNARISKQWAEIGFQGDDPKTDFRGMGILGLINLVYFSENYTSEAHQILSRSNHPKLGYSYAIVGTNLTEMAYSLLKSEALKFHLYNLVPGIPTMEHFHQFYCYLVYEFDKFWFEEEPESIMYFNLYREKFHEKIKGLLLDRNVALTLKV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELMOD2 ELMO/CED-12 domain containing 2 [ Homo sapiens ]
• Official Symbol: ELMOD2
• Synonyms: ELMOD2; ELMO/CED-12 domain containing 2; ELMO domain containing 2; ELMO domain-containing protein 2; MGC10084; 9830169G11Rik; FLJ35768; FLJ38038
• Gene ID: 255520
• mRNA Refseq: NM_153702
• Protein Refseq: NP_714913
• MIM: 610196
• UniProt ID: Q8IZ81