Recombinant Human ELK3

Description :	The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present.
Protein length :	100 amino acids
Molecular Weight :	36.630kDa inclusive of tags
Source :	Wheat germ
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
Sequence Similarities :	Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Tag :	Non

Gene Name	ELK3 ELK3, ETS-domain protein (SRF accessory protein 2) [ Homo sapiens ]
Official Symbol	ELK3
Synonyms	ELK3; ELK3, ETS-domain protein (SRF accessory protein 2); ETS domain-containing protein Elk-3; ERP; NET; SAP2;
Gene ID	2004
mRNA Refseq	NM_005230
Protein Refseq	NP_005221
MIM	600247
Uniprot ID	P41970
Chromosome Location	12q23
Pathway	Id Signaling Pathway, organism-specific biosystem;
Function	protein binding; purine-rich negative regulatory element binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;