Recombinant Human ELK1 Protein, GST-tagged

• Cat.No.: ELK1-3243H
• Product Overview: Human ELK1 partial ORF ( NP_005220, 67 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum response element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade. This gene produces multiple isoforms by using alternative translational start codons and by alternative splicing. Related pseudogenes have been identified on chromosomes 7 and 14. [provided by RefSeq, Mar 2012]
• Molecular Mass: 36.74 kDa
• AA Sequence: YYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELK1 ELK1, member of ETS oncogene family [ Homo sapiens ]
• Official Symbol: ELK1
• Synonyms: ELK1; ELK1, member of ETS oncogene family; ETS domain-containing protein Elk-1; ETS-like gene 1; tyrosine kinase (ELK1) oncogene
• Gene ID: 2002
• mRNA Refseq: NM_001114123
• Protein Refseq: NP_001107595
• MIM: 311040
• UniProt ID: P19419