Recombinant Human ELAVL4 Protein, GST-tagged

• Cat.No.: ELAVL4-3235H
• Product Overview: Human ELAVL4 partial ORF ( NP_068771, 312 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ELAVL4 (ELAV Like RNA Binding Protein 4) is a Protein Coding gene. Diseases associated with ELAVL4 include Hallucinogen Abuse and Paraneoplastic Neurologic Disorders. GO annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is ELAVL2.
• Molecular Mass: 33.33 kDa
• AA Sequence: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ]
• Official Symbol: ELAVL4
• Synonyms: ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM; hu-antigen D; paraneoplastic encephalomyelitis antigen HuD; Embryonic lethal, abnormal vision, Drosophila, homolog of, like-4
• Gene ID: 1996
• mRNA Refseq: NM_001144774
• Protein Refseq: NP_001138246
• MIM: 168360
• UniProt ID: P26378