Recombinant Human EIF4G2 Protein, GST-tagged

• Cat.No.: EIF4G2-3211H
• Product Overview: Human EIF4G2 partial ORF ( NP_001409, 811 a.a. - 889 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008]
• Molecular Mass: 34.43 kDa
• AA Sequence: SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF4G2 eukaryotic translation initiation factor 4 gamma, 2 [ Homo sapiens ]
• Official Symbol: EIF4G2
• Synonyms: EIF4G2; eukaryotic translation initiation factor 4 gamma, 2; eukaryotic translation initiation factor 4 gamma 2; DAP5; NAT1; p97; DAP-5; eIF4G 2; eIF-4G 2; eIF-4-gamma 2; aging-associated protein 1; death-associated protein 5; eukaryotic translation initiation factor 4G-like 1; P97; AAG1; FLJ41344
• Gene ID: 1982
• mRNA Refseq: NM_001042559
• Protein Refseq: NP_001036024
• MIM: 602325
• UniProt ID: P78344