Recombinant Human EIF3D, His-tagged

• Cat.No.: EIF3D-26387TH
• Product Overview: Recombinant fragment, corresponding to amino acids 148-330 of Human EIF3D with an N terminal His tag; Predicted MWt 22 kDa.

Specification

• Description: Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 84 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEV SEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFH TVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVY SWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQD EGNSFNSPRNLAMEATYINHNFSQQCLRM
• Sequence Similarities: Belongs to the eIF-3 subunit D family.
• Protein length: 148-330 a.a.

Gene Information

• Gene Name: EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ]
• Official Symbol: EIF3D
• Synonyms: EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d
• Gene ID: 8664
• mRNA Refseq: NM_003753
• Protein Refseq: NP_003744
• MIM: 603915
• Uniprot ID: O15371
• Chromosome Location: 22q13.1
• Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem
• Function: protein binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity