Recombinant Human EIF3D, His-tagged

Cat.No. : EIF3D-26387TH
Product Overview : Recombinant fragment, corresponding to amino acids 148-330 of Human EIF3D with an N terminal His tag; Predicted MWt 22 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 148-330 a.a.
Description : Eukaryotic translation initiation factor-3 (eIF3), the largest of the eIFs, is a multiprotein complex composed of at least ten nonidentical subunits. The complex binds to the 40S ribosome and helps maintain the 40S and 60S ribosomal subunits in a dissociated state. It is also thought to play a role in the formation of the 40S initiation complex by interacting with the ternary complex of eIF2/GTP/methionyl-tRNA, and by promoting mRNA binding. The protein encoded by this gene is the major RNA binding subunit of the eIF3 complex.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 84 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLMKMRYLEV SEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFH TVTTTDDPVIRKLAKTQGNVFATDAILATLMSCTRSVY SWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQD EGNSFNSPRNLAMEATYINHNFSQQCLRM
Sequence Similarities : Belongs to the eIF-3 subunit D family.
Gene Name EIF3D eukaryotic translation initiation factor 3, subunit D [ Homo sapiens ]
Official Symbol EIF3D
Synonyms EIF3D; eukaryotic translation initiation factor 3, subunit D; EIF3S7, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa; eukaryotic translation initiation factor 3 subunit D; eIF3 p66; eIF3 zeta; eIF3d;
Gene ID 8664
mRNA Refseq NM_003753
Protein Refseq NP_003744
MIM 603915
Uniprot ID O15371
Chromosome Location 22q13.1
Pathway Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem;
Function protein binding; contributes_to translation initiation factor activity; contributes_to translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF3D Products

Required fields are marked with *

My Review for All EIF3D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon