Recombinant Human EIF2B3, His-tagged

Description :	The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation :	HIS
Source :	E. coli
Form :	Lyophilised:Reconstitute with 66 μl aqua dest.
Storage buffer :	Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage :	Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	LLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYC LKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQ GQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACW NACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEA NRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTV EEGSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence Similarities :	Belongs to the eIF-2B gamma/epsilon subunits family.
Protein length :	167-452 a.a.

Gene Name	EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa [ Homo sapiens ]
Official Symbol	EIF2B3
Synonyms	EIF2B3; eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); translation initiation factor eIF-2B subunit gamma; EIF 2B; EIF2Bgamma;
Gene ID	8891
mRNA Refseq	NM_020365
Protein Refseq	NP_065098
MIM	606273
Uniprot ID	Q9NR50
Chromosome Location	1p34.1
Pathway	Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; RNA transport, organism-specific biosystem;
Function	contributes_to guanyl-nucleotide exchange factor activity; contributes_to guanyl-nucleotide exchange factor activity; nucleotidyltransferase activity; protein binding; contributes_to translation factor activity, nucleic acid binding;

COA

Cat.No. :	EIF2B3-28491TH
Product Overview :	Recombinant fragment, corresponding to amino acids 167-452 of Human eIF2B3 with an N terminal His tag. Predicted MWt: 33 kDa;