Recombinant Human EIF2B3, His-tagged

Cat.No. : EIF2B3-28491TH
Product Overview : Recombinant fragment, corresponding to amino acids 167-452 of Human eIF2B3 with an N terminal His tag. Predicted MWt: 33 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 167-452 a.a.
Description : The protein encoded by this gene is one of the subunits of initiation factor eIF2B, which catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. It has also been found to function as a cofactor of hepatitis C virus internal ribosome entry site-mediated translation. Mutations in this gene have been associated with leukodystrophy with vanishing white matter. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 66 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LLFMANEADLDEELVIKGSILQKHPRIRFHTGLVDAHLYC LKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQ GQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACW NACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEA NRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTV EEGSNIQGSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Sequence Similarities : Belongs to the eIF-2B gamma/epsilon subunits family.
Gene Name EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa [ Homo sapiens ]
Official Symbol EIF2B3
Synonyms EIF2B3; eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); translation initiation factor eIF-2B subunit gamma; EIF 2B; EIF2Bgamma;
Gene ID 8891
mRNA Refseq NM_020365
Protein Refseq NP_065098
MIM 606273
Uniprot ID Q9NR50
Chromosome Location 1p34.1
Pathway Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Gene Expression, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; RNA transport, organism-specific biosystem;
Function contributes_to guanyl-nucleotide exchange factor activity; contributes_to guanyl-nucleotide exchange factor activity; nucleotidyltransferase activity; protein binding; contributes_to translation factor activity, nucleic acid binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF2B3 Products

Required fields are marked with *

My Review for All EIF2B3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon