Recombinant Human EI24 Protein, GST-tagged
Cat.No. : | EI24-3138H |
Product Overview : | Human EI24 full-length ORF ( AAH02390, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8. [provided by RefSeq, Feb 2014] |
Molecular Mass : | 63.14 kDa |
AA Sequence : | MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATSGH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EI24 EI24, autophagy associated transmembrane protein [ Homo sapiens (human) ] |
Official Symbol | EI24 |
Synonyms | EI24; EI24, autophagy associated transmembrane protein; EI24, Autophagy Associated Transmembrane Protein; P53-Induced Gene 8 Protein; Etoposide Induced 2.4; PIG8; Ectopic P-Granules Autophagy Protein 4 Homolog (C. Elegans); Ectopic P-Granules Autophagy Protein 4 Homolog; Etoposide-Induced Protein 2.4 Homolog; Tumor Protein P53 Inducible Protein 8; Etoposide Induced 2.4 MRNA; TP53I8; EPG4; etoposide-induced protein 2.4 homolog; ectopic P-granules autophagy protein 4 homolog; etoposide induced 2.4; p53-induced gene 8 protein; tumor protein p53 inducible protein 8 |
Gene ID | 9538 |
mRNA Refseq | NM_001290135 |
Protein Refseq | NP_001277064 |
MIM | 605170 |
UniProt ID | O14681 |
◆ Recombinant Proteins | ||
EI24-2615Z | Recombinant Zebrafish EI24 | +Inquiry |
EI24-4395HF | Recombinant Full Length Human EI24 Protein, GST-tagged | +Inquiry |
RFL26501MF | Recombinant Full Length Mouse Etoposide-Induced Protein 2.4(Ei24) Protein, His-Tagged | +Inquiry |
EI24-2040R | Recombinant Rat EI24 Protein | +Inquiry |
EI24-1231R | Recombinant Rhesus Macaque EI24 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EI24-6683HCL | Recombinant Human EI24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EI24 Products
Required fields are marked with *
My Review for All EI24 Products
Required fields are marked with *
0
Inquiry Basket