Recombinant Human EI24 Protein, GST-tagged

Cat.No. : EI24-3138H
Product Overview : Human EI24 full-length ORF ( AAH02390, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic cell death through the caspase 9 and mitochondrial pathways. This gene is located on human chromosome 11q24, a region frequently altered in cancers. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 1, 3, 7, and 8. [provided by RefSeq, Feb 2014]
Molecular Mass : 63.14 kDa
AA Sequence : MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCCAWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFLSNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATSGH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EI24 EI24, autophagy associated transmembrane protein [ Homo sapiens (human) ]
Official Symbol EI24
Synonyms EI24; EI24, autophagy associated transmembrane protein; EI24, Autophagy Associated Transmembrane Protein; P53-Induced Gene 8 Protein; Etoposide Induced 2.4; PIG8; Ectopic P-Granules Autophagy Protein 4 Homolog (C. Elegans); Ectopic P-Granules Autophagy Protein 4 Homolog; Etoposide-Induced Protein 2.4 Homolog; Tumor Protein P53 Inducible Protein 8; Etoposide Induced 2.4 MRNA; TP53I8; EPG4; etoposide-induced protein 2.4 homolog; ectopic P-granules autophagy protein 4 homolog; etoposide induced 2.4; p53-induced gene 8 protein; tumor protein p53 inducible protein 8
Gene ID 9538
mRNA Refseq NM_001290135
Protein Refseq NP_001277064
MIM 605170
UniProt ID O14681

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EI24 Products

Required fields are marked with *

My Review for All EI24 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon