Recombinant Human EGFL6 Protein, GST-tagged

• Cat.No.: EGFL6-3114H
• Product Overview: Human EGFL6 partial ORF ( AAH38587, 431 a.a. - 530 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the epidermal growth factor (EGF) repeat superfamily. Members of this superfamily are characterized by the presence of EGF-like repeats and are often involved in the regulation of cell cycle, proliferation, and developmental processes. The gene product contains a signal peptide, suggesting that it is secreted; an EGF repeat region consisting of 4 complete EGF-like repeats and 1 partial EGF-like repeat, 3 of which have a calcium-binding consensus sequence; an arg-gly-asp integrin association motif; and a MAM domain, which is believed to have an adhesive function. This gene is expressed early during development, and its expression has been detected in lung and meningioma tumors. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.63 kDa
• AA Sequence: GFYMAVPALAGHKKDIGRLKLLLPDLQPQSNFCLLFDYRLAGDKVGKLRVFVKNSNNALAWEKTTSEDEKWKTGKIQLYQGTDATKSIIFEAERGKGKTG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EGFL6 EGF like domain multiple 6 [ Homo sapiens (human) ]
• Official Symbol: EGFL6
• Synonyms: EGFL6; EGF like domain multiple 6; EGF Like Domain Multiple 6; MAM And EGF Domains-Containing Gene Protein; MAM And EGF Domain Containing; EGF-Like Protein 6; MAEG; Epidermal Growth Factor-Like Protein 6; EGF Repeat-Containing Protein 6; EGF-Like-Domain, Multiple 6; W80; epidermal growth factor-like protein 6; EGF repeat-containing protein 6; EGF-like protein 6; MAM and EGF domain containing; MAM and EGF domains-containing gene protein
• Gene ID: 25975
• mRNA Refseq: NM_001167890
• Protein Refseq: NP_001161362
• MIM: 300239
• UniProt ID: Q8IUX8