Recombinant Human EGF, StrepII-tagged
Cat.No. : | EGF-214H |
Product Overview : | Purified, full-length human recombinant Epidermal growth factor or EGF protein (amino acids 971-1023, 53 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 6.2 kDa. (Accession NP_001954.2; UniProt P01133) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 971-1023, 53 a.a. |
Description : | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
Chromosome Location | 4q25 |
Pathway | Arf6 signaling events, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; |
Function | calcium ion binding; epidermal growth factor receptor binding; growth factor activity; protein binding; transmembrane receptor protein tyrosine kinase activator activity; |
◆ Recombinant Proteins | ||
Egf-055M | Recombinant Mouse Egf Protein, MYC/DDK-tagged | +Inquiry |
Egf-898M | Recombinant Mouse Egf Protein, His&SUMO-tagged | +Inquiry |
EGF-479H | Recombinant Human EGF, Met | +Inquiry |
EGF-547H | Active Recombinant Mouse Epidermal Growth Factor, HIgG1 Fc-tagged | +Inquiry |
EGF-899P | Recombinant Pig EGF Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Egf -634M | Active Native Mouse Egf protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
Egf-635R | Native Rat Egf | +Inquiry |
EGF-23H | Active Native Human EGF protein | +Inquiry |
Egf-634M | Active Native Mouse Egf | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGF-2716HCL | Recombinant Human EGF cell lysate | +Inquiry |
EGF-973MCL | Recombinant Mouse EGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGF Products
Required fields are marked with *
My Review for All EGF Products
Required fields are marked with *
0
Inquiry Basket