Recombinant Human EGF, StrepII-tagged

• Cat.No.: EGF-214H
• Product Overview: Purified, full-length human recombinant Epidermal growth factor or EGF protein (amino acids 971-1023, 53 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 6.2 kDa. (Accession NP_001954.2; UniProt P01133)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 971-1023, 53 a.a.
• Description: EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: EGF epidermal growth factor [ Homo sapiens ]
• Official Symbol: EGF
• Synonyms: EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4
• Gene ID: 1950
• mRNA Refseq: NM_001178130
• Protein Refseq: NP_001171601
• MIM: 131530
• UniProt ID: P01133
• Chromosome Location: 4q25
• Pathway: Arf6 signaling events, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem
• Function: calcium ion binding; epidermal growth factor receptor binding; growth factor activity; protein binding; transmembrane receptor protein tyrosine kinase activator activity