Recombinant Human EGF, StrepII-tagged

Cat.No. : EGF-214H
Product Overview : Purified, full-length human recombinant Epidermal growth factor or EGF protein (amino acids 971-1023, 53 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 6.2 kDa. (Accession NP_001954.2; UniProt P01133)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 971-1023, 53 a.a.
Description : EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
AA Sequence : NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Endotoxin : <0.1 eu per ug protein by lal
Purity : >95% pure by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name EGF epidermal growth factor [ Homo sapiens ]
Official Symbol EGF
Synonyms EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID 1950
mRNA Refseq NM_001178130
Protein Refseq NP_001171601
MIM 131530
UniProt ID P01133
Chromosome Location 4q25
Pathway Arf6 signaling events, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Ceramide signaling pathway, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem;
Function calcium ion binding; epidermal growth factor receptor binding; growth factor activity; protein binding; transmembrane receptor protein tyrosine kinase activator activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EGF Products

Required fields are marked with *

My Review for All EGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon