Description :	EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. This receptor also binds with TGF-α and VGF (vaccinia virus growth factor).
Source :	E. coli
Species :	Human
AA Sequence :	NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Purity :	≥ 98% by SDS-PAGE gel and HPLC analyses.

Gene Name	EGF epidermal growth factor [ Homo sapiens (human) ]
Official Symbol	EGF
Synonyms	EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4;
Gene ID	1950
mRNA Refseq	NM_001178130
Protein Refseq	NP_001171601
MIM	131530
UniProt ID	P01133

BMP2-123H	GMP Recombinant Human BMP2	+Inquiry
IFNA1-86H	Active GMP Recombinant Human IFNA1 protein	+Inquiry
IL1A-4315HG	GMP Recombinant Human IL1A protein	+Inquiry
IL1B-4316HG	GMP Recombinant Human IL1B protein	+Inquiry
IL2-4317HG	GMP Recombinant Human IL2 protein	+Inquiry

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	EGF-27HG
Product Overview :	GMP Recombinant Human EGF protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials.

Recombinant Human EGF Protein, GMP Grade, Animal-Free