Recombinant Human EGF protein(981-1020 aa), C-His-tagged

• Cat.No.: EGF-2508H
• Product Overview: Recombinant Human EGF protein(P01133)(981-1020 aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: His
• Protein length: 981-1020 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: DGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: EGF epidermal growth factor [ Homo sapiens ]
• Official Symbol: EGF
• Synonyms: EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4
• Gene ID: 1950
• mRNA Refseq: NM_001178130
• Protein Refseq: NP_001171601
• MIM: 131530
• UniProt ID: P01133