Specification
Gene Information
Related Products
Download

Description :	This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin that has been implicated in proliferation and metastasis of several types of cancers.
Source :	HEK293
Species :	Human
Tag :	Fc
Form :	Lyophilized
Molecular Mass :	43 kDa
Protein length :	201
AA Sequence :	MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDTPSPLCLLLLLLLLILRLLRIL
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	EFNA4 ephrin-A4 [ Homo sapiens (human) ]
Official Symbol	EFNA4
Synonyms	EFNA4; ephrin-A4; EPLG4; LERK4; LERK-4; ligand of eph-related kinase 4; eph-related receptor tyrosine kinase ligand 4; EFL4; FLJ57652; MGC125826;
Gene ID	1945
mRNA Refseq	NM_005227
Protein Refseq	NP_005218
MIM	601380
UniProt ID	P52798