Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EEF1B2-5455H |
Product Overview : | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. |
Molecular Mass : | 24.8 kDa |
AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ] |
Official Symbol | EEF1B2 |
Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1; EF1B; EEF1B; EEF1B1; |
Gene ID | 1933 |
mRNA Refseq | NM_021121 |
Protein Refseq | NP_066944 |
MIM | 600655 |
UniProt ID | P24534 |
◆ Recombinant Proteins | ||
EEF1B2-478C | Recombinant Cynomolgus EEF1B2 Protein, His-tagged | +Inquiry |
EEF1B2-460HFL | Active Recombinant Full Length Human EEF1B2 Protein, C-Flag-tagged | +Inquiry |
EEF1B2-365H | Recombinant Human EEF1B2 protein, His-tagged | +Inquiry |
EEF1B2-804H | Recombinant Human EEF1B2 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1B2-5455H | Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *
0
Inquiry Basket