Recombinant Human EDA Protein, His/Flag/StrepII-tagged

• Cat.No.: EDA-3041H
• Product Overview: Purified EDA (NP_001390.1 245 a.a. - 391 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Description: The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Source: Human cells
• Species: Human
• Tag: His&Flag&StrepII
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 21.45 kDa
• AA Sequence: ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
• Applications: Western Blot
  Enzyme-linked Immunoabsorbent Assay
  SDS-PAGE
  Protein Interaction
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
• Protein length: 245-391 a.a.

Gene Information

• Gene Name: EDA ectodysplasin A [ Homo sapiens ]
• Official Symbol: EDA
• Synonyms: EDA; ectodysplasin A; ectodermal dysplasia 1, anhidrotic , ED1, EDA2, ODT1, oligodontia 1; ectodysplasin-A; ED1 A1; ED1 A2; EDA1; HED; XHED; XLHED; oligodontia 1; ectodermal dysplasia protein; X-linked anhidroitic ectodermal dysplasia protein; ED1; EDA2; ODT1; ED1-A1; ED1-A2; STHAGX1
• Gene ID: 1896
• mRNA Refseq: NM_001005609
• Protein Refseq: NP_001005609
• MIM: 300451
• UniProt ID: Q92838