Recombinant Human ECHS1, His-tagged

• Cat.No.: ECHS1-28225TH
• Product Overview: Recombinant full length Human Mitochondrial ECHS1 with an N terminal His tag ,

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 263 amino acids
• Description: The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature.
• Conjugation: HIS
• Molecular Weight: 30.600kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKIFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

Gene Information

• Gene Name: ECHS1 enoyl CoA hydratase, short chain, 1, mitochondrial [ Homo sapiens ]
• Official Symbol: ECHS1
• Synonyms: ECHS1; enoyl CoA hydratase, short chain, 1, mitochondrial; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial; enoyl-CoA hydratase, mitochondrial; SCEH
• Gene ID: 1892
• mRNA Refseq: NM_004092
• Protein Refseq: NP_004083
• MIM: 602292
• Uniprot ID: P30084
• Chromosome Location: 10q26.2-q26.3
• Pathway: Beta oxidation of butanoyl-CoA to acetyl-CoA, organism-specific biosystem; Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of hexanoyl-CoA to butanoyl-CoA, organism-specific biosystem; Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of octanoyl-CoA to hexanoyl-CoA, organism-specific biosystem
• Function: enoyl-CoA hydratase activity; lyase activity; protein binding