Recombinant Human ECHDC1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ECHDC1-2302H
• Product Overview: ECHDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001132982) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Decarboxylates ethylmalonyl-CoA, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activity at lower level.
• Molecular Mass: 33.5 kDa
• AA Sequence: MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIAKKGKFNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ECHDC1 enoyl CoA hydratase domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: ECHDC1
• Synonyms: ECHDC1; enoyl CoA hydratase domain containing 1; enoyl Coenzyme A hydratase domain containing 1; ethylmalonyl-CoA decarboxylase; dJ351K20.2; methylmalonyl-CoA decarboxylase; enoyl-CoA hydratase domain-containing protein 1; MMCD; FLJ40827; DKFZp762M1110
• Gene ID: 55862
• mRNA Refseq: NM_001139510
• Protein Refseq: NP_001132982
• MIM: 612136
• UniProt ID: Q9NTX5