Recombinant Human EAF2 Protein, GST-tagged

Cat.No. : EAF2-3014H
Product Overview : Human EAF2 full-length ORF ( NP_060926.2, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : EAF2 (ELL Associated Factor 2) is a Protein Coding gene. Diseases associated with EAF2 include Eaf and Childhood Leukemia. Among its related pathways are Gene Expression and Formation of HIV elongation complex in the absence of HIV Tat. GO annotations related to this gene include RNA polymerase II regulatory region sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding. An important paralog of this gene is EAF1.
Molecular Mass : 55.2 kDa
AA Sequence : MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EAF2 ELL associated factor 2 [ Homo sapiens (human) ]
Official Symbol EAF2
Synonyms EAF2; ELL associated factor 2; ELL Associated Factor 2; Testosterone-Regulated Apoptosis Inducer And Tumor Suppressor Protein; TRAITS; ELL-Associated Factor 2; BM040; U19; ELL-associated factor 2; testosterone-regulated apoptosis inducer and tumor suppressor protein
Gene ID 55840
mRNA Refseq NM_001320041
Protein Refseq NP_001306970
MIM 607659
UniProt ID Q96CJ1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EAF2 Products

Required fields are marked with *

My Review for All EAF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon