Recombinant Human DUT protein, His-tagged

• Cat.No.: DUT-791H
• Product Overview: Recombinant Human DUT(Met1-Asn164) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Met1-Asn164
• Description: Deoxyuridine5'-TriphosphateNucleotidohydrolaseMitochondrial(dUTPase)belongstothedUTPasefamily.dUTPaseexitsasahomotrimerandisinvolvedinnucleotidemetabolism.dUTPaseproducesdUMP,theimmediateprecursorofthymidinenucleotidesanditdecreasestheintracellularconcentrationofdUTPsothaturacilcannotbeincorporatedintoDNA.ThedUTPaseincreaseinPCRproductyield,lengthandfidelityenablesfurtherdown-streamapplications.TheseeffectsmakedUTPaseusefulinPCRfidelityandyield-sensitiveapplications. dUTPase is specific for dUTP and is critical for the fidelity of DNA replication and repair.
• Form: Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYD YTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIA QLICERIFYPEIEEVQALDDTERGSGGFGSTGKN
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Store at < -20 centigrade, stable for 6 months after receipt.Please minimize freeze-thaw cycles.
• Shipping: The product is shipped on dry ice/polar packs.Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: DUT deoxyuridine triphosphatase [ Homo sapiens ]
• Official Symbol: DUT
• Synonyms: DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; dUTP nucleotidohydrolase; FLJ20622
• Gene ID: 1854
• mRNA Refseq: NM_001025248
• Protein Refseq: NP_001020419
• MIM: 601266
• UniProt ID: P33316
• Chromosome Location: 15q21.1
• Pathway: Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; Pyrimidine metabolism, conserved biosystem
• Function: dUTP diphosphatase activity; hydrolase activity; protein binding