Recombinant Human DUSP6 protein, His-tagged

• Cat.No.: DUSP6-3133H
• Product Overview: Recombinant Human DUSP6 protein(73-133 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 73-133 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: VRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESLLGLLLKKLKDEGCRAFYLE
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DUSP6 dual specificity phosphatase 6 [ Homo sapiens ]
• Official Symbol: DUSP6
• Synonyms: DUSP6; dual specificity phosphatase 6; dual specificity protein phosphatase 6; MKP 3; PYST1; MAP kinase phosphatase 3; dual specificity protein phosphatase PYST1; serine/threonine specific protein phosphatase; mitogen-activated protein kinase phosphatase 3; MKP3
• Gene ID: 1848
• mRNA Refseq: NM_001946
• Protein Refseq: NP_001937
• MIM: 602748
• UniProt ID: Q16828