Recombinant Human DUSP26 Protein, GST-tagged

• Cat.No.: DUSP26-2937H
• Product Overview: Human DUSP26 full-length ORF ( NP_076930.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the tyrosine phosphatase family of proteins and exhibits dual specificity by dephosphorylating tyrosine as well as serine and threonine residues. This gene has been described as both a tumor suppressor and an oncogene depending on the cellular context. This protein may regulate neuronal proliferation and has been implicated in the progression of glioblastoma through its ability to dephosphorylate the p53 tumor suppressor. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2015]
• Molecular Mass: 50.3 kDa
• AA Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP26 dual specificity phosphatase 26 (putative) [ Homo sapiens ]
• Official Symbol: DUSP26
• Synonyms: DUSP26; dual specificity phosphatase 26 (putative); dual specificity protein phosphatase 26; DUSP24; MGC1136; DSP-4; MKP-8; MAP kinase phosphatase 8; dual specificity phosphatase SKRP3; dual-specificity phosphatase SKRP3; mitogen-activated protein kinase phosphatase 8; Novel amplified gene in thyroid anaplastic cancer; low-molecular-mass dual-specificity phosphatase 4; MKP8; LDP-4; NATA1; SKRP3; MGC2627
• Gene ID: 78986
• mRNA Refseq: NM_024025
• Protein Refseq: NP_076930
• UniProt ID: Q9BV47