Recombinant Human DUS3L Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DUS3L-1102H |
Product Overview : | DUS3L MS Standard C13 and N15-labeled recombinant protein (NP_064560) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DUS3L (Dihydrouridine Synthase 3 Like) is a Protein Coding gene. Diseases associated with DUS3L include Myopathy, Congenital, Compton-North and Cholestasis-Lymphedema Syndrome. Gene Ontology (GO) annotations related to this gene include tRNA dihydrouridine synthase activity. An important paralog of this gene is DUS1L. |
Molecular Mass : | 72.5 kDa |
AA Sequence : | MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DUS3L dihydrouridine synthase 3 like [ Homo sapiens (human) ] |
Official Symbol | DUS3L |
Synonyms | DUS3L; dihydrouridine synthase 3-like (S. cerevisiae); tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like; DUS3; FLJ13896; |
Gene ID | 56931 |
mRNA Refseq | NM_020175 |
Protein Refseq | NP_064560 |
UniProt ID | Q96G46 |
◆ Recombinant Proteins | ||
Dus3l-2680M | Recombinant Mouse Dus3l Protein, Myc/DDK-tagged | +Inquiry |
DUS3L-1971R | Recombinant Rat DUS3L Protein | +Inquiry |
DUS3L-2712H | Recombinant Human DUS3L Protein, MYC/DDK-tagged | +Inquiry |
DUS3L-10943Z | Recombinant Zebrafish DUS3L | +Inquiry |
DUS3L-2919H | Recombinant Human DUS3L Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUS3L-514HCL | Recombinant Human DUS3L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUS3L Products
Required fields are marked with *
My Review for All DUS3L Products
Required fields are marked with *
0
Inquiry Basket