Recombinant Human DUS3L Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DUS3L-1102H
• Product Overview: DUS3L MS Standard C13 and N15-labeled recombinant protein (NP_064560) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: DUS3L (Dihydrouridine Synthase 3 Like) is a Protein Coding gene. Diseases associated with DUS3L include Myopathy, Congenital, Compton-North and Cholestasis-Lymphedema Syndrome. Gene Ontology (GO) annotations related to this gene include tRNA dihydrouridine synthase activity. An important paralog of this gene is DUS1L.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 72.5 kDa
• AA Sequence: MAEGTAEAPLENGGGGDSGAGALERGVAPIKRQYLTTKEQFHQFLEAKGQEKTCRETEVGDPAGNELAEPEAKRIRLEDGQTADGQTEEAAEPGEQLQTQKRARGQNKGRPHVKPTNYDKNRLCPSLIQESAAKCFFGDRCRFLHDVGRYLETKPADLGPRCVLFETFGRCPYGVTCRFAGAHLGPEGQNLVQEELAARGTQPPSIRNGLDKALQQQLRKREVRFERAEQALRRFSQGPTPAAAVPEGTAAEGAPRQENCGAQQVPAGPGTSTPPSSPVRTCGPLTDEDVVRLRPCEKKRLDIRGKLYLAPLTTCGNLPFRRICKRFGADVTCGEMAVCTNLLQGQMSEWALLKRHQCEDIFGVQLEGAFPDTMTKCAELLSRTVEVDFVDINVGCPIDLVYKKGGGCALMNRSTKFQQIVRGMNQVLDVPLTVKIRTGVQERVNLAHRLLPELRDWGVALVTLHGRSREQRYTKLADWQYIEECVQAASPMPLFGNGDILSFEDANRAMQTGVTGIMIARGALLKPWLFTEIKEQRHWDISSSERLDILRDFTNYGLEHWGSDTQGVEKTRRFLLEWLSFLCRYVPVGLLERLPQRINERPPYYLGRDYLETLMASQKAADWIRISEMLLGPVPPSFAFLPKHKANAYKSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DUS3L dihydrouridine synthase 3 like [ Homo sapiens (human) ]
• Official Symbol: DUS3L
• Synonyms: DUS3L; dihydrouridine synthase 3-like (S. cerevisiae); tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like; DUS3; FLJ13896
• Gene ID: 56931
• mRNA Refseq: NM_020175
• Protein Refseq: NP_064560
• UniProt ID: Q96G46