Recombinant Human DSG1 protein(391-540 aa), C-His-tagged

• Cat.No.: DSG1-2820H
• Product Overview: Recombinant Human DSG1 protein(Q02413)(391-540 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 391-540 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 18.5 kDa
• AASequence: TYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: DSG1 desmoglein 1 [ Homo sapiens ]
• Official Symbol: DSG1
• Synonyms: DSG1; desmoglein 1; DSG; desmoglein-1; CDHF4; DGI; cadherin family member 4; desmosomal glycoprotein 1; pemphigus foliaceus antigen; DG1; PPKS1; SPPK1
• Gene ID: 1828
• mRNA Refseq: NM_001942
• Protein Refseq: NP_001933
• MIM: 125670
• UniProt ID: Q02413