Recombinant Human DSG1 protein(391-540 aa), C-His-tagged

Cat.No. : DSG1-2820H
Product Overview : Recombinant Human DSG1 protein(Q02413)(391-540 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 391-540 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 18.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TYVVTGNMGSNDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTKEQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKITTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLL
Gene Name DSG1 desmoglein 1 [ Homo sapiens ]
Official Symbol DSG1
Synonyms DSG1; desmoglein 1; DSG; desmoglein-1; CDHF4; DGI; cadherin family member 4; desmosomal glycoprotein 1; pemphigus foliaceus antigen; DG1; PPKS1; SPPK1;
Gene ID 1828
mRNA Refseq NM_001942
Protein Refseq NP_001933
MIM 125670
UniProt ID Q02413

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DSG1 Products

Required fields are marked with *

My Review for All DSG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon