Recombinant Human DPP6 Protein, GST-tagged

• Cat.No.: DPP6-2847H
• Product Overview: Human DPP6 full-length ORF (1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
• Molecular Mass: 46.5 kDa
• AA Sequence: MELAALGLSPCPRLLHAELLPGLLTVFSLRFLQDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMTKVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQVQYACYSVLNLEQDIPFMEKDLTGVQGLLLQQTRLCCGGRC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPP6 dipeptidyl-peptidase 6 [ Homo sapiens ]
• Official Symbol: DPP6
• Synonyms: DPP6; dipeptidyl-peptidase 6; dipeptidylpeptidase 6 , dipeptidylpeptidase VI; dipeptidyl aminopeptidase-like protein 6; DPPX; DPP VI; dipeptidylpeptidase 6; dipeptidyl peptidase 6; dipeptidylpeptidase VI; dipeptidyl peptidase VI; dipeptidyl peptidase IV-like protein; dipeptidyl peptidase IV-related protein; dipeptidyl aminopeptidase-related protein; dipeptidyl aminopeptidase IV-related protein; VF2; FLJ55680; MGC46605
• Gene ID: 1804
• mRNA Refseq: NM_001039350
• Protein Refseq: NP_001034439
• MIM: 126141
• UniProt ID: P42658