Recombinant Human DNTT Protein, GST-tagged

• Cat.No.: DNTT-2797H
• Product Overview: Human DNTT partial ORF ( AAH12920, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the DNA polymerase type-X family and encodes a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, the encoded protein is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor gene segments. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.51 kDa
• AA Sequence: MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIEC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNTT deoxynucleotidyltransferase, terminal [ Homo sapiens ]
• Official Symbol: DNTT
• Synonyms: DNTT; deoxynucleotidyltransferase, terminal; DNA nucleotidylexotransferase; TDT; Terminal deoxynucleotidyltransferase; terminal transferase; terminal addition enzyme; terminal deoxynucleotidyltransferase; terminal deoxyribonucleotidyltransferase; nucleosidetriphosphate:DNA deoxynucleotidylexotransferase
• Gene ID: 1791
• mRNA Refseq: NM_001017520
• Protein Refseq: NP_001017520
• MIM: 187410
• UniProt ID: P04053