Recombinant Human DNAJC15 Protein, GST-tagged

• Cat.No.: DNAJC15-2752H
• Product Overview: Human DNAJD1 full-length ORF ( AAH10910, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DNAJC15 (DnaJ Heat Shock Protein Family (Hsp40) Member C15) is a Protein Coding gene. Diseases associated with DNAJC15 include Cicatricial Entropion. An important paralog of this gene is DNAJC19.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 42.24 kDa
• AA Sequence: MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQGLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC15 DnaJ (Hsp40) homolog, subfamily C, member 15 [ Homo sapiens ]
• Official Symbol: DNAJC15
• Synonyms: DNAJC15; DnaJ (Hsp40) homolog, subfamily C, member 15; DnaJ (Hsp40) homolog, subfamily D, member 1 , DNAJD1; dnaJ homolog subfamily C member 15; MCJ; DNAJ domain-containing; methylation-controlled J protein; cell growth-inhibiting gene 22 protein; DnaJ (Hsp40) homolog, subfamily D, member 1; HSD18; DNAJD1
• Gene ID: 29103
• mRNA Refseq: NM_013238
• Protein Refseq: NP_037370
• MIM: 615339
• UniProt ID: Q9Y5T4