Recombinant Human DNAJB1 Protein, N-6×His-tagged

• Cat.No.: DNAJB1-036H
• Product Overview: Recombinant human DNAJB1 protein with N-6×His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 340
• Description: This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.
• Form: Solution
• Molecular Mass: 40.2 kDa
• AA Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
• Purity: > 95%
• Applications: WB
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: 4°C
• Concentration: 1 mg/mL
• Storage Buffer: Tris (pH 8). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: DNAJB1 DnaJ heat shock protein family (Hsp40) member B1 [ Homo sapiens (human) ]
• Official Symbol: DNAJB1
• Synonyms: DNAJB1; DnaJ heat shock protein family (Hsp40) member B1; Hdj1; Sis1; HSPF1; Hsp40; RSPH16B; dnaJ homolog subfamily B member 1; DnaJ (Hsp40) homolog, subfamily B, member 1; dnaJ protein homolog 1; heat shock 40 kDa protein 1; human DnaJ protein 1; radial spoke 16 homolog B
• Gene ID: 3337
• mRNA Refseq: NM_006145
• Protein Refseq: NP_006136
• MIM: 604572
• UniProt ID: P25685