Recombinant Human DNAJB1 Protein, GST-tagged

• Cat.No.: DNAJB1-2730H
• Product Overview: Human DNAJB1 full-length ORF ( AAH19827, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2015]
• Molecular Mass: 63.14 kDa
• AA Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJB1 DnaJ (Hsp40) homolog, subfamily B, member 1 [ Homo sapiens ]
• Official Symbol: DNAJB1
• Synonyms: DNAJB1; DnaJ (Hsp40) homolog, subfamily B, member 1; HSPF1; dnaJ homolog subfamily B member 1; Hsp40; radial spoke 16 homolog B (Chlamydomonas); RSPH16B; Sis1; hDj-1; human DnaJ protein 1; heat shock protein 40; dnaJ protein homolog 1; heat shock 40kD protein 1; radial spoke 16 homolog B; heat shock 40 kDa protein 1; DnaJ (Hsp40) homolog, subfmaily B, member 1; Hdj1
• Gene ID: 3337
• mRNA Refseq: NM_006145
• Protein Refseq: NP_006136
• MIM: 604572
• UniProt ID: P25685