Recombinant Human DMAC1 Protein

• Cat.No.: DMAC1-0183H
• Product Overview: Human C9orf123 full-length ORF (ADZ15990.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: DMAC1 (distal membrane arm assembly complex 1) is a Protein Coding gene.
• Form: Liquid
• Molecular Mass: 12.8 kDa
• AA Sequence: MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSCRVLSGLGLMGAGGYVYWVARKPMKMGYPPSPWTITQMVIGLSENQGIATWGIVVMADPKGKAYRVV
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: DMAC1 distal membrane arm assembly complex 1 [ Homo sapiens (human) ]
• Official Symbol: DMAC1
• Synonyms: DMAC1; distal membrane arm assembly complex 1; C9ORF123; chromosome 9 open reading frame 123; transmembrane protein C9orf123; MGC4730
• Gene ID: 90871
• mRNA Refseq: NM_033428
• Protein Refseq: NP_219500
• MIM: 617261
• UniProt ID: Q96GE9