Recombinant Human DLX5 protein, GST-tagged

Cat.No. : DLX5-28H
Product Overview : Recombinant Human DLX5(1 a.a. - 289 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-289 a.a.
Description : This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 57.53 kDa
AA Sequence : MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQY QYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLA ALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWE PQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DLX5 distal-less homeobox 5 [ Homo sapiens ]
Official Symbol DLX5
Synonyms DLX5; distal-less homeobox 5; distal less homeo box 5; homeobox protein DLX-5; distal-less homeo box 5; split hand/foot malformation type 1 with sensorineural hearing loss; SHFM1D;
Gene ID 1749
mRNA Refseq NM_005221
Protein Refseq NP_005212
MIM 600028
UniProt ID P56178
Chromosome Location 7q21.3
Function HMG box domain binding; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DLX5 Products

Required fields are marked with *

My Review for All DLX5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon