Recombinant Human DLX5 protein, GST-tagged

• Cat.No.: DLX5-28H
• Product Overview: Recombinant Human DLX5(1 a.a. - 289 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-289 a.a.
• Description: This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein may play a role in bone development and fracture healing. Mutation in this gene, which is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7, may be associated with split-hand/split-foot malformation.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 57.53 kDa
• AA Sequence: MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCSPTSASYGKALNPYQY QYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEKEVTEPEVRMVNGKPKKVRKPRTIYSSFQLA ALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWE PQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: DLX5 distal-less homeobox 5 [ Homo sapiens ]
• Official Symbol: DLX5
• Synonyms: DLX5; distal-less homeobox 5; distal less homeo box 5; homeobox protein DLX-5; distal-less homeo box 5; split hand/foot malformation type 1 with sensorineural hearing loss; SHFM1D
• Gene ID: 1749
• mRNA Refseq: NM_005221
• Protein Refseq: NP_005212
• MIM: 600028
• UniProt ID: P56178
• Chromosome Location: 7q21.3
• Function: HMG box domain binding; transcription regulatory region DNA binding; transcription regulatory region sequence-specific DNA binding