Recombinant Human DKK4, His-tagged
Cat.No. : | DKK4-78H |
Product Overview : | Recombinant Human Dickkopf-Related Protein 4/DKK4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu19-Leu224) of Human DKK4 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-224 a.a. |
Description : | Dickkopf-Related Protein 4 (DKK4) is a member of the DKK protein family that includes DKK1, DKK2, DKK3, and DKK4. DKK1 and DKK4 are Wnt antagonists. DKK1 and DKK4 antagonize Wnt/β-Catenin signaling by direct high affinity binding to the Wnt coreceptor LRP5/6 and inhibiting interaction of LRP5/6 with the Wnt Frizzled complex. DKK1 and DKK4 also bind the transmembrane proteins Kremen1 (Krm1) and Kremen 2 (Krm2) with high affinity. Krm2 has been shown to form a ternary complex with DKK1or DKK4 and LRP5/LRP6 to trigger internalization of the complex and removal of LRP6 from the cell surface. Thus, DKK1/DKK4 and Kremens function synergistically to antagonize LRP5/LRP6 mediated Wnt activity. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. |
Form : | Lyophilized from a 0.2 μM filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0 |
AA Sequence : | LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGT LCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRT FDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHA RLRVCQKIEKLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | DKK4 dickkopf homolog 4 (Xenopus laevis) [ Homo sapiens ] |
Official Symbol | DKK4 |
Synonyms | DKK4; dickkopf homolog 4 (Xenopus laevis); dickkopf (Xenopus laevis) homolog 4; dickkopf-related protein 4; hDkk-4; dickkopf-4; DKK-4; MGC129562; MGC129563; |
Gene ID | 27121 |
mRNA Refseq | NM_014420 |
Protein Refseq | NP_055235 |
MIM | 605417 |
UniProt ID | Q9UBT3 |
Chromosome Location | 8p11.2-p11.1 |
Pathway | Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
Function | molecular_function; |
◆ Recombinant Proteins | ||
DKK4-2085H | Recombinant Human DKK4 Protein (Gln107-His212), N-His tagged | +Inquiry |
DKK4-4612M | Recombinant Mouse DKK4 Protein | +Inquiry |
DKK4-2668H | Recombinant Human DKK4 Protein, GST-tagged | +Inquiry |
Dkk4-404M | Active Recombinant Mouse Dickkopf Homolog 4 (Xenopus laevis), His-tagged | +Inquiry |
DKK4-681H | Active Recombinant Human DKK4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DKK4-6915HCL | Recombinant Human DKK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DKK4 Products
Required fields are marked with *
My Review for All DKK4 Products
Required fields are marked with *
0
Inquiry Basket