Recombinant Human DKK4, His-tagged

• Cat.No.: DKK4-78H
• Product Overview: Recombinant Human Dickkopf-Related Protein 4/DKK4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu19-Leu224) of Human DKK4 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Dickkopf-Related Protein 4 (DKK4) is a member of the DKK protein family that includes DKK1, DKK2, DKK3, and DKK4. DKK1 and DKK4 are Wnt antagonists. DKK1 and DKK4 antagonize Wnt/β-Catenin signaling by direct high affinity binding to the Wnt coreceptor LRP5/6 and inhibiting interaction of LRP5/6 with the Wnt Frizzled complex. DKK1 and DKK4 also bind the transmembrane proteins Kremen1 (Krm1) and Kremen 2 (Krm2) with high affinity. Krm2 has been shown to form a ternary complex with DKK1or DKK4 and LRP5/LRP6 to trigger internalization of the complex and removal of LRP6 from the cell surface. Thus, DKK1/DKK4 and Kremens function synergistically to antagonize LRP5/LRP6 mediated Wnt activity. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μM filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0
• AA Sequence: LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGT LCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRT FDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHA RLRVCQKIEKLVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Protein length: 19-224 a.a.

Gene Information

• Gene Name: DKK4 dickkopf homolog 4 (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: DKK4
• Synonyms: DKK4; dickkopf homolog 4 (Xenopus laevis); dickkopf (Xenopus laevis) homolog 4; dickkopf-related protein 4; hDkk-4; dickkopf-4; DKK-4; MGC129562; MGC129563
• Gene ID: 27121
• mRNA Refseq: NM_014420
• Protein Refseq: NP_055235
• MIM: 605417
• UniProt ID: Q9UBT3
• Chromosome Location: 8p11.2-p11.1
• Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem
• Function: molecular_function