Recombinant Human DKK4, His-tagged

Cat.No. : DKK4-78H
Product Overview : Recombinant Human Dickkopf-Related Protein 4/DKK4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu19-Leu224) of Human DKK4 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-224 a.a.
Description : Dickkopf-Related Protein 4 (DKK4) is a member of the DKK protein family that includes DKK1, DKK2, DKK3, and DKK4. DKK1 and DKK4 are Wnt antagonists. DKK1 and DKK4 antagonize Wnt/β-Catenin signaling by direct high affinity binding to the Wnt coreceptor LRP5/6 and inhibiting interaction of LRP5/6 with the Wnt Frizzled complex. DKK1 and DKK4 also bind the transmembrane proteins Kremen1 (Krm1) and Kremen 2 (Krm2) with high affinity. Krm2 has been shown to form a ternary complex with DKK1or DKK4 and LRP5/LRP6 to trigger internalization of the complex and removal of LRP6 from the cell surface. Thus, DKK1/DKK4 and Kremens function synergistically to antagonize LRP5/LRP6 mediated Wnt activity. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
Form : Lyophilized from a 0.2 μM filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0
AA Sequence : LVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEKPFCATCRGLRRRCQRDAMCCPGT LCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPVQENQPKRKPSIKKSQGRKGQEGESCLRT FDCGPGLCCARHFWTKICKPVLLEGQVCSRRGHKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHA RLRVCQKIEKLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name DKK4 dickkopf homolog 4 (Xenopus laevis) [ Homo sapiens ]
Official Symbol DKK4
Synonyms DKK4; dickkopf homolog 4 (Xenopus laevis); dickkopf (Xenopus laevis) homolog 4; dickkopf-related protein 4; hDkk-4; dickkopf-4; DKK-4; MGC129562; MGC129563;
Gene ID 27121
mRNA Refseq NM_014420
Protein Refseq NP_055235
MIM 605417
UniProt ID Q9UBT3
Chromosome Location 8p11.2-p11.1
Pathway Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function molecular_function;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DKK4 Products

Required fields are marked with *

My Review for All DKK4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon