Recombinant Human DKK1 Protein, Strep-tagged

Description :	This gene encodes a member of the dickkopf family of proteins. Members of this family are secreted proteins characterized by two cysteine-rich domains that mediate protein-protein interactions. The encoded protein binds to the LRP6 co-receptor and inhibits beta-catenin-dependent Wnt signaling. This gene plays a role in embryonic development and may be important in bone formation in adults. Elevated expression of this gene has been observed in numerous human cancers and this protein may promote proliferation, invasion and growth in cancer cell lines.
Source :	HEK293
Species :	Human
Tag :	Strep
Form :	Lyophilized
Molecular Mass :	28.8 kDa
Protein length :	266
AA Sequence :	MMALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH
Purity :	> 98%
Applications :	WB; ELISA; FACS; FC
Stability :	This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage :	At -20 centigrade.
Concentration :	1 mg/mL
Storage Buffer :	PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution :	Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Name	DKK1 dickkopf 1 homolog (Xenopus laevis) [ Homo sapiens (human) ]
Official Symbol	DKK1
Synonyms	DKK1; dickkopf 1 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 1; dickkopf-related protein 1; DKK 1; SK; hDkk-1; dickkopf-1 like; dickkopf related protein-1; DKK-1;
Gene ID	22943
mRNA Refseq	NM_012242
Protein Refseq	NP_036374
MIM	605189
UniProt ID	O94907

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry