Recombinant Human DKC1 protein, GST-tagged

• Cat.No.: DKC1-261H
• Product Overview: Recombinant Human DKC1(1 a.a. - 514 a.a.), fussed with GST at N-terminal, was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 84.1 kDa
• Protein length: 1 a.a. - 514 a.a.
• AA Sequence: MADAEVIILPKKHKKKKERKSLPEEDVAEIQHAEEFLIKPESKVAKLDTSQWPLLLKNFDKLNVRTTHYTPLACG SNPLKREIGDYIRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPKVTGCLIVCIERATRLVKSQQSAG KEYVGIVRLHNAIEGGTQLSRALETLTGALFQRPPLIAAVKRQLRVRTIYESKMIEYDPERRLGIFWVSCEAGTY IRTLCVHLGLLLGVGGQMQELRRVRSGVMSEKDHMVTMHDVLDAQWLYDNHKDESYLRRVVYPLEKLLTSHKRLV MKDSAVNAICYGAKIMLPGVLRYEDGIEVNQEIVVITTKGEAICMAIALMTTAVISTCDHGIVAKIKRVIMERDT YPRKWGLGPKASQKKLMIKQGLLDKHGKPTDSTPATWKQEYVDYSESAKKEVVAEVVKAPQVVAEAAKTAKRKRE SESESDETPPAAPQLIKKEKKKSKKDKKAKAGLESGAEPGDGDSDTTKKKKKKKKAKEVELVSE
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: DKC1 dyskeratosis congenita 1, dyskerin [ Homo sapiens ]
• Official Symbol: DKC1
• Synonyms: DKC1; dyskeratosis congenita 1, dyskerin; DKC; H/ACA ribonucleoprotein complex subunit 4; dyskerin; NAP57; NOLA4; XAP101; CBF5 homolog; cbf5p homolog; snoRNP protein DKC1; nucleolar protein NAP57; nucleolar protein family A member 4; nopp140-associated protein of 57 kDa; CBF5; DKCX; FLJ97620
• Gene ID: 1736
• mRNA Refseq: NM_001363
• Protein Refseq: NP_001354
• MIM: 300126
• UniProt ID: O60832
• Chromosome Location: Xq28
• Pathway: Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; Extension of Telomeres, organism-specific biosystem; H/ACA ribonucleoprotein complex, organism-specific biosystem; Regulation of Telomerase, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem
• Function: RNA binding; isomerase activity; protein binding; pseudouridine synthase activity; telomerase activity