Recombinant Human DIS3L2 protein, GST-tagged
Cat.No. : | DIS3L2-3773H |
Product Overview : | Recombinant Human DIS3L2 protein(99-201 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 99-201 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | VVARNRALNGDLVVVKLLPEEHWKVVKPESNDKETEAAYESDIPEELCGHHLPQQSLKSYNDSPDVIVEAQFDGSDSEDGHGITQNVLVDGVKKLSVCVSEKG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DIS3L2 DIS3 mitotic control homolog (S. cerevisiae)-like 2 [ Homo sapiens ] |
Official Symbol | DIS3L2 |
Synonyms | DIS3L2; DIS3 mitotic control homolog (S. cerevisiae)-like 2; FAM6A, family with sequence similarity 6, member A; DIS3-like exonuclease 2; FLJ36974; MGC42174; family with sequence similarity 6, member A; FAM6A; PRLMNS; |
Gene ID | 129563 |
mRNA Refseq | NM_001257281 |
Protein Refseq | NP_001244210 |
MIM | 614184 |
UniProt ID | Q8IYB7 |
◆ Recombinant Proteins | ||
DIS3L2-28352TH | Recombinant Human DIS3L2, His-tagged | +Inquiry |
DIS3L2-2385M | Recombinant Mouse DIS3L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Dis3l2-2570M | Recombinant Mouse Dis3l2 Protein, Myc/DDK-tagged | +Inquiry |
DIS3L2-765H | Recombinant Human DIS3L2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DIS3L2-4604M | Recombinant Mouse DIS3L2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DIS3L2-1103HCL | Recombinant Human DIS3L2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DIS3L2 Products
Required fields are marked with *
My Review for All DIS3L2 Products
Required fields are marked with *
0
Inquiry Basket