Recombinant Human DIRAS3 Protein, GST-tagged

• Cat.No.: DIRAS3-2638H
• Product Overview: Human DIRAS3 full-length ORF ( AAH05362, 1 a.a. - 229 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the ras superfamily. This gene is imprinted gene with monoallelic expression of the paternal allele which is associated with growth suppression. The encoded protein acts as a tumor suppressor whose function is abrogated in many ovarian and breast cancers. This protein may also play a role autophagy in certain cancer cells by regulating the autophagosome initiation complex. [provided by RefSeq, Nov 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 50.93 kDa
• AA Sequence: MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DIRAS3 DIRAS family, GTP-binding RAS-like 3 [ Homo sapiens ]
• Official Symbol: DIRAS3
• Synonyms: DIRAS3; DIRAS family, GTP-binding RAS-like 3; ARHI, ras homolog gene family, member I; GTP-binding protein Di-Ras3; NOEY2; ras homolog gene family, member I; rho-related GTP-binding protein RhoI; distinct subgroup of the Ras family member 3; ARHI
• Gene ID: 9077
• mRNA Refseq: NM_004675
• Protein Refseq: NP_004666
• MIM: 605193
• UniProt ID: O95661