Recombinant Human DIRAS1, His-tagged

Cat.No. : DIRAS1-28349TH
Product Overview : Recombinant full length Human DIRAS1 with an N terminal His tag; 215 amino acids with tag, Predicted MWt 24.1 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 195 amino acids
Description : DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.
Conjugation : HIS
Molecular Weight : 24.100kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKC
Gene Name DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ]
Official Symbol DIRAS1
Synonyms DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG;
Gene ID 148252
mRNA Refseq NM_145173
Protein Refseq NP_660156
MIM 607862
Uniprot ID O95057
Chromosome Location 19p13.3
Function GTP binding; GTPase activity; nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DIRAS1 Products

Required fields are marked with *

My Review for All DIRAS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon