Recombinant Human DGKG Protein (1-255 aa), His-SUMO-tagged

• Cat.No.: DGKG-454H
• Product Overview: Recombinant Human DGKG Protein (1-255 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Description: Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 44.9 kDa
• Protein length: 1-255 aa
• AA Sequence: MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: DGKG diacylglycerol kinase, gamma 90kDa [ Homo sapiens ]
• Official Symbol: DGKG
• Synonyms: DGKG; DAGK3; DGK-GAMMA; MGC104993; MGC133330
• Gene ID: 1608
• mRNA Refseq: NM_001080744
• Protein Refseq: NP_001074213
• MIM: 601854
• UniProt ID: P49619