Recombinant Human DGAT2 protein, GST-tagged

Cat.No. : DGAT2-27396TH
Product Overview : Recombinant Human DGAT2(1 a.a. - 388 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-388 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 70.2 kDa
AA Sequence : MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLNRSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ]
Official Symbol DGAT2
Synonyms DGAT2; diacylglycerol O-acyltransferase 2; diacylglycerol O acyltransferase homolog 2 (mouse); diglyceride acyltransferase 2; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; HMFN1045; GS1999FULL; DKFZp686A15125;
Gene ID 84649
mRNA Refseq NM_001253891
Protein Refseq NP_001240820
MIM 606983
UniProt ID Q96PD7
Chromosome Location 11q13.3
Function 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; transferase activity, transferring acyl groups other than amino-acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DGAT2 Products

Required fields are marked with *

My Review for All DGAT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon