Recombinant Human DGAT2, GST-tagged
Cat.No. : | DGAT2-27398H |
Product Overview : | Recombinant Human DGAT2 (289 a.a. - 388 a.a.) fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of two enzymes which catalyzes the final reaction in the synthesis of triglycerides in which diacylglycerol is covalently bound to long chain fatty acyl-CoAs. The encoded protein catalyzes this reaction at low concentrations of magnesium chloride while the other enzyme has high activity at high concentrations of magnesium chloride. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 36.74 kDa |
Sequence : | IFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN |
Storagebuffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
OfficialSymbol : | DGAT2 |
Gene Name | DGAT2 diacylglycerol O-acyltransferase 2 [ Homo sapiens ] |
Synonyms | DGAT2; diacylglycerol O-acyltransferase 2; ARAT; HMFN1045; GS1999FULL; diglyceride acyltransferase 2; retinol O-fatty-acyltransferase; acyl-CoA retinol O-fatty-acyltransferase; diacylglycerol O-acyltransferase homolog 2; diacylglycerol O-acyltransferase-like protein 2; EC 2.3.1.20; EC 2.3.1.76 |
Gene ID | 84649 |
mRNA Refseq | NM_032564 |
Protein Refseq | NP_115953 |
MIM | 606983 |
UniProt ID | Q96PD7 |
Chromosome Location | 11q13.5 |
Pathway | Fat digestion and absorption; Fatty acid, triacylglycerol, and ketone body metabolism; Glycerolipid metabolism |
Function | 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein homodimerization activity; retinol O-fatty-acyltransferase activity |
◆ Recombinant Proteins | ||
DGAT2-6906HF | Recombinant Full Length Human DGAT2 Protein, GST-tagged | +Inquiry |
DGAT2-1511R | Recombinant Rat DGAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DGAT2-3299Z | Recombinant Zebrafish DGAT2 | +Inquiry |
DGAT2-27398H | Recombinant Human DGAT2, GST-tagged | +Inquiry |
RFL11813XF | Recombinant Full Length Xenopus Tropicalis Diacylglycerol O-Acyltransferase 2(Dgat2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGAT2-6965HCL | Recombinant Human DGAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGAT2 Products
Required fields are marked with *
My Review for All DGAT2 Products
Required fields are marked with *
0
Inquiry Basket