Recombinant Human DFFA protein, GST-tagged

• Cat.No.: DFFA-2817H
• Product Overview: Recombinant Human DFFA protein(O00273)(1-331aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 63.6 kDa
• Protein length: 1-331aa
• AA Sequence: MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIVDDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIILLSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQEESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: DFFA DNA fragmentation factor, 45kDa, alpha polypeptide [ Homo sapiens ]
• Official Symbol: DFFA
• Synonyms: DFFA; DNA fragmentation factor, 45kDa, alpha polypeptide; DNA fragmentation factor, 45 kD, alpha polypeptide; DNA fragmentation factor subunit alpha; DFF 45; DFF1; DFF45; DNA fragmentation factor; 45 kD; alpha subunit; ICAD; inhibitor of CAD; DNA fragmentation factor 45 kDa subunit; DFF-45
• Gene ID: 1676
• mRNA Refseq: NM_004401
• Protein Refseq: NP_004392
• MIM: 601882
• UniProt ID: O00273