Recombinant Human DES protein, EGFP-tagged
Cat.No. : | DES-323H |
Product Overview : | Recombinant Human DES protein(P17661)(2-470aa), fused with C-terminal EGFP tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | EGFP |
Protein Length : | 2-470aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 80.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL |
Gene Name | DES desmin [ Homo sapiens ] |
Official Symbol | DES |
Synonyms | DES; desmin; CMD1I; CSM1; CSM2; intermediate filament protein; FLJ12025; FLJ39719; FLJ41013; FLJ41793; |
Gene ID | 1674 |
mRNA Refseq | NM_001927 |
Protein Refseq | NP_001918 |
MIM | 125660 |
UniProt ID | P17661 |
◆ Recombinant Proteins | ||
DES-289H | Recombinant Human DES protein, His/MBP-tagged | +Inquiry |
DES-534H | Recombinant Human DES Protein, His-tagged | +Inquiry |
DES-2676H | Recombinant Human DES protein(91-460 aa), C-His-tagged | +Inquiry |
DES-1071R | Recombinant Rhesus Macaque DES Protein, His (Fc)-Avi-tagged | +Inquiry |
DES-4526M | Recombinant Mouse DES Protein | +Inquiry |
◆ Native Proteins | ||
DES-167C | Native chicken DES | +Inquiry |
◆ Cell & Tissue Lysates | ||
DES-6969HCL | Recombinant Human DES 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DES Products
Required fields are marked with *
My Review for All DES Products
Required fields are marked with *
0
Inquiry Basket