Recombinant Human DEGS1 Protein, GST-tagged

Cat.No. : DEGS1-2527H
Product Overview : Human DEGS1 full-length ORF ( NP_003667.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. [provided by RefSeq, Mar 2010]
Molecular Mass : 64.3 kDa
AA Sequence : MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DEGS1 delta(4)-desaturase, sphingolipid 1 [ Homo sapiens ]
Official Symbol DEGS1
Synonyms DEGS1; delta(4)-desaturase, sphingolipid 1; degenerative spermatocyte homolog 1, lipid desaturase (Drosophila); sphingolipid delta(4)-desaturase DES1; DEGS 1; Des 1; DES1; FADS7; MLD; sphingolipid delta(4) desaturase 1; membrane lipid desaturase; dihydroceramide desaturase; sphingolipid delta 4 desaturase; migration-inducing gene 15 protein; sphingolipid delta(4)-desaturase 1; membrane fatty acid (lipid) desaturase; cell migration-inducing gene 15 protein; degenerative spermatocyte homolog, lipid desaturase; degenerative spermatocyte homolog 1, lipid desaturase; DEGS; Des-1; MIG15; DEGS-1; MGC5079;
Gene ID 8560
mRNA Refseq NM_003676
Protein Refseq NP_003667
MIM 615843
UniProt ID O15121

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEGS1 Products

Required fields are marked with *

My Review for All DEGS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon