Recombinant Human DEFB131A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DEFB131A-5557H
• Product Overview: DEFB131 MS Standard C13 and N15-labeled recombinant protein (NP_001035538) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Defensins are cysteine-rich cationic polypeptides that are important in the immunologic response to invading microorganisms. The antimicrobial protein encoded by this gene is secreted and is a member of the beta defensin protein family. Beta defensin genes are found in several clusters throughout the genome, with this gene mapping to a cluster at 4p16.
• Molecular Mass: 8 kDa
• AA Sequence: MRVLFFVFGVLSLMFTVPPGRSFISNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIEIDGQKKWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DEFB131A defensin beta 131A [ Homo sapiens (human) ]
• Official Symbol: DEFB131A
• Synonyms: DEFB131A; defensin beta 131A; DEFB-31; DEFB131; beta-defensin 131A; beta-defensin 131; beta-defensin 31; defensin beta 131; defensin, beta 31
• Gene ID: 644414
• mRNA Refseq: NM_001040448
• Protein Refseq: NP_001035538
• UniProt ID: P59861