Recombinant Human DEFA1, GST-tagged

Cat.No. : DEFA1-2155H
Product Overview : RecombinantHuman protein DEFA1 with GST-tag at N-terminal was produced in wheat germ expressionsystem in vitro and purified by GlutathioneSepharose 4 Fast Flow, 36.08 KDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Defensins are a family of microbicidal and cytotoxic peptidesthought to be involved in host defense. They are abundant in the granules ofneutrophils and also found in the epithelia of mucosal surfaces such as thoseof the intestine, respiratory tract, urinary tract, and vagina. Members of thedefensin family are highly similar in protein sequence and distinguished by aconserved cysteine motif. The protein encoded by this gene, defensin, alpha1, is found in the microbicidal granules of neutrophils and likely plays arole in phagocyte-mediated host defense. Several alpha defensin genes areclustered on chromosome 8. This gene differs from defensin, alpha 3 by onlyone amino acid. This gene and the gene encoding defensin, alpha 3 are bothsubject to copy number variation.
AminoAcid Sequence : MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
Note : Best usewithin three months from the date of receipt of this protein.
Applications : ELISA;WB; Antibody Production; Protein Array
Storage Buffer : 50 mMTris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Storage : Storeat -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name DEFA1 defensin, alpha 1 [ Homo sapiens ]
Official Symbol DEFA1
Synonyms DEFA1;defensin, alpha 1; HP1; MRS; DEF1; HP-1; DEFA2; HNP-1; DEFA1B; MGC138393; neutrophildefensin 1; defensin, alpha 2; myeloid-related sequence; defensin, alpha 1,myeloid-related sequence; OTTHUMP00000196017
Gene ID 1667
mRNA Refseq NM_004084
Protein Refseq NP_004075
MIM 125220
UniProt ID P59665
Chromosome Location 8p23.1
Pathway Alpha-defensins;Cellular roles of Anthrax toxin; Defensins; Immune System; Innate ImmuneSystem

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DEFA1 Products

Required fields are marked with *

My Review for All DEFA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon