Recombinant Human DDX49 Protein, GST-tagged
Cat.No. : | DDX49-2496H |
Product Overview : | Human DDX49 full-length ORF ( NP_061943.2, 1 a.a. - 483 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DDX49 (DEAD-Box Helicase 49) is a Protein Coding gene. Among its related pathways are rRNA processing in the nucleus and cytosol and Gene Expression. GO annotations related to this gene include nucleic acid binding and ATP-dependent RNA helicase activity. |
Molecular Mass : | 80.6 kDa |
AA Sequence : | MAGFAELGLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQKLSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGRLADHLRSSNTFSIKKIRFLVMDEADRLLEQGCTDFTVDLEAILAAVPARRQTLLFSATLTDTLRELQGLATNQPFFWEAQAPVSTVEQLDQRYLLVPEKVKDAYLVHLIQRFQDEHEDWSIIIFTNTCKTCQILCMMLRKFSFPTVALHSMMKQKERFAALAKFKSSIYRILIATDVASRGLDIPTVQVVINHNTPGLPKIYIHRVGRTARAGRQGQAITLVTQYDIHLVHAIEEQIKKKLEEFSVEEAEVLQILTQVNVVRRECEIKLEAAHFDEKKEINKRKQLILEGKDPDLEAKRKAELAKIKQKNRRFKEKVEETLKRQKAGRAGHKGRPPRTPSGSHSGPVPSQGLV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DDX49 DEAD (Asp-Glu-Ala-Asp) box polypeptide 49 [ Homo sapiens ] |
Official Symbol | DDX49 |
Synonyms | DDX49; DEAD (Asp-Glu-Ala-Asp) box polypeptide 49; probable ATP-dependent RNA helicase DDX49; FLJ10432; DEAD box protein 49; R27090_2; |
Gene ID | 54555 |
mRNA Refseq | NM_019070 |
Protein Refseq | NP_061943 |
UniProt ID | Q9Y6V7 |
◆ Recombinant Proteins | ||
DDX49-2275M | Recombinant Mouse DDX49 Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX49-2627C | Recombinant Chicken DDX49 | +Inquiry |
DDX49-9824Z | Recombinant Zebrafish DDX49 | +Inquiry |
DDX49-2496H | Recombinant Human DDX49 Protein, GST-tagged | +Inquiry |
DDX49-2618HF | Recombinant Full Length Human DDX49 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX49 Products
Required fields are marked with *
My Review for All DDX49 Products
Required fields are marked with *
0
Inquiry Basket